- PSPC1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83801
- PSPC1
- PSP1
- Unconjugated
- PBS (pH 7.2), 40% Glycerol
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
- Human, Mouse, Rat
- This antibody was developed against Recombinant Protein corresponding to amino acids: PAMGPEGAAN MGTPMMPDNG AVHNDRFPQG PPSQMGSPMG SRTGSETPQA PMSGVGPVSG GPGGFGRGSQ GGNFEGPNKR RRY
- 0.1 ml (also 25ul)
- Rabbit
- paraspeckle component 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
Specifications/Features
Available conjugates: Unconjugated